PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv2_042510_dwuo.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 406aa    MW: 45708.5 Da    PI: 5.2929
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv2_042510_dwuo.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.9e-10109167563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         kr++r   NR +A rs +RK  +++eLe+kvk+L++e +aL  +l+  k     l+se+
  Bv2_042510_dwuo.t1 109 KRAKRILANRQSAARSKERKARYMQELEKKVKSLQTEATALSVQLSLFKRDTTGLTSEN 167
                         9********************************************99999988888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-15105169IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.668107170IPR004827Basic-leucine zipper domain
PfamPF001703.2E-8109166IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.43E-10109160No hitNo description
Gene3DG3DSA:1.20.5.1702.4E-8109180No hitNo description
CDDcd147035.52E-21110159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGHRRVHSEI FLRFPDEISF GGSMEGGDDA NDILATYMDM EKIDNFGENG NQPVKLNHNQ  60
KLRHCFSVDE FSGFSSNNQN DQNIGLPSCE AKKAMPPNKL AELWIVDPKR AKRILANRQS  120
AARSKERKAR YMQELEKKVK SLQTEATALS VQLSLFKRDT TGLTSENIEL RRELESMEQQ  180
AHLRDALNDA LKQELDRLKI ATGDTLVPAD AFAMPLHSIP CHLEQQQQPS PSPFESNMLS  240
ISHAPPALDS VQRQMPVICP PEMNFHTSHQ PVVDPPIEAN SSQKLCSFEA NMLNSAQEPK  300
FCTELYLPLE SCKPRMSQFG STEANMNYVP QPMDSPLGHL PPYHFESQTQ SPEQEIYNMT  360
SQSHMQMPKQ DNISQFQGLD INAFDSYQLV KVEGPSIIAN ESMGGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010670608.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P42e-61RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0J8FLH50.0A0A0J8FLH5_BETVU; Uncharacterized protein
STRINGVIT_13s0067g02900.t014e-69(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-67bZIP family protein